DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED20 and mdt-20

DIOPT Version :9

Sequence 1:NP_001260223.1 Gene:MED20 / 43952 FlyBaseID:FBgn0013531 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001367680.1 Gene:mdt-20 / 176937 WormBaseID:WBGene00007020 Length:198 Species:Caenorhabditis elegans


Alignment Length:225 Identity:64/225 - (28%)
Similarity:105/225 - (46%) Gaps:35/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVTILQPYPLPEGKSGAHIIDQLSKRLLALGATHAGQFLVDCETFISTPQPHNGAPGRAVHVLH 65
            ||||.:.     |.:..|..:::|   |.::|....|.|:||...| :.|.|.:..|...  |:|
 Worm     1 MGVTWVF-----EAEQTAKSVERL---LESIGGDLHGTFIVDVTPF-NPPTPSSDYPSNV--VMH 54

  Fly    66 NSEYPASTFSIIDNGT-GKQVAIVADNIFDLLMLKMTNTFTSKKQTKIESRGARFE-YGDFVIKL 128
            :|:.|.|||||....| .|....|.|..|||::.|:::...:....|||..|..:. |.|::|::
 Worm    55 HSKCPQSTFSICPKDTFKKSPKAVCDRGFDLILSKLSSGLIADNAGKIEIIGNEYSLYKDWMIRV 119

  Fly   129 GSVTMMEHFKGILIEIEYKSCVILAYCWEMIREMLQGFLGIAVNKDFPSYF----APQTIMTAMG 189
            |:.|.....||:::||||...:|:..|.:|:.|.::.... ..::..|..|    .|::      
 Worm   120 GTATQGTTVKGVVVEIEYDPSIIVIQCKDMMIEFVKSVFN-KYHETLPEIFKITEKPES------ 177

  Fly   190 QQQLHAKHNDIFEPMDTVKQYLEQFTNYRK 219
                       :..:||:.|||...|..||
 Worm   178 -----------YTALDTMWQYLGIATKLRK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED20NP_001260223.1 Med20 1..215 CDD:285776 61/219 (28%)
mdt-20NP_001367680.1 Med20 1..192 CDD:400779 61/219 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159164
Domainoid 1 1.000 72 1.000 Domainoid score I6084
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3158
Inparanoid 1 1.050 73 1.000 Inparanoid score I3882
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007370
OrthoInspector 1 1.000 - - oto18746
orthoMCL 1 0.900 - - OOG6_104763
Panther 1 1.100 - - LDO PTHR12465
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2634
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.890

Return to query results.
Submit another query.