DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED20 and Gm20517

DIOPT Version :9

Sequence 1:NP_001260223.1 Gene:MED20 / 43952 FlyBaseID:FBgn0013531 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001351862.1 Gene:Gm20517 / 112694759 MGIID:5141982 Length:150 Species:Mus musculus


Alignment Length:149 Identity:63/149 - (42%)
Similarity:95/149 - (63%) Gaps:6/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVTILQPYPLPEGKSGAHIIDQLSKRLLALGATHAGQFLVDCETF--ISTPQPHNGAPGRAVHV 63
            ||||.:...|:.||||....::.|:|:|..|||...|.|.|||||:  .::.....|..|:.::|
Mouse     1 MGVTCVSQMPVAEGKSLQQTVELLTKKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQAGKLMYV 65

  Fly    64 LHNSEYPASTFSIIDNGTGKQVAIVADNIFDLLMLKMTNTFTSKKQTKIESRGARFEYGDFVIKL 128
            :||||||.|.|::.:||.    .::||..||:||:|:...|.|.|.:|||:||.|::|.||::|:
Mouse    66 MHNSEYPLSCFALFENGP----CLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKV 126

  Fly   129 GSVTMMEHFKGILIEIEYK 147
            |:|||....:||.:|:..|
Mouse   127 GTVTMGPSARGISVEVTEK 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED20NP_001260223.1 Med20 1..215 CDD:285776 63/149 (42%)
Gm20517NP_001351862.1 Med20 1..>149 CDD:312207 63/149 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104763
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.790

Return to query results.
Submit another query.