DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(r) and Clec2l

DIOPT Version :10

Sequence 1:NP_524662.1 Gene:e(r) / 43951 FlyBaseID:FBgn0011586 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001094977.1 Gene:Clec2l / 665180 MGIID:2141402 Length:211 Species:Mus musculus


Alignment Length:32 Identity:6/32 - (18%)
Similarity:15/32 - (46%) Gaps:0/32 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 MVYQKSTNTYAPYNKDWIKEKIYVLLRQAAFS 101
            ::|.:....::...:||...:.|....:||.:
Mouse   102 LLYGRKCYYFSEEPRDWNTGRQYCHTHEAALA 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(r)NP_524662.1 ER 2..99 CDD:460078 4/28 (14%)
Clec2lNP_001094977.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
CLECT_NK_receptors_like 97..207 CDD:153063 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.