DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cds and CDS4

DIOPT Version :9

Sequence 1:NP_001286976.1 Gene:Cds / 43950 FlyBaseID:FBgn0010350 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_566035.2 Gene:CDS4 / 819123 AraportID:AT2G45150 Length:430 Species:Arabidopsis thaliana


Alignment Length:337 Identity:85/337 - (25%)
Similarity:116/337 - (34%) Gaps:131/337 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 MICGF--ALIIYGGPLALMITTLLVQVKCFQEIISIGYQVYRIHGLPWFRSLSWYFLLTSNYFFY 155
            :||..  .|.:|.|.:.:::|:...       :::|...|.|  |.|.|..||            
plant   202 VICALMPILTLYFGNIDILVTSAAF-------VVAIALLVQR--GSPRFAQLS------------ 245

  Fly   156 GENLVDYFGVVINRVEYLKFLVTYHRFLSFALYI------IGFVWFVLSLVKKYYIKQFSLFAWT 214
                ...||:.     |..:|.::...|...|..      ||..|.:|...:.:         ||
plant   246 ----STMFGLF-----YCGYLPSFWVKLRCGLAAPALNTGIGRTWPILLGGQAH---------WT 292

  Fly   215 HVSLLIVVTQSYLIIQNIFEGLIWFIVPVSMIVCNDVMAYVFGFFFGRTPLIKLSPKKTWEGFIG 279
                               .||:..::..|.::..|..|::.|..||||||..:||||||||.|.
plant   293 -------------------VGLVATLISFSGVIATDTFAFLGGKTFGRTPLTSISPKKTWEGTIV 338

  Fly   280 GGFATVLFGILFSYVLCNYQYFICPIQYSEEQGRMTMSCVPSYLFTPQEYSLKLFGIGKTLNLYP 344
            |....:...||.|                            .||..||                 
plant   339 GLVGCIAITILLS----------------------------KYLSWPQ----------------- 358

  Fly   345 FIWHSISLSLFSSIIGPFGGFFASGF--------KRAFKIKDFGDMIPGHGGIMDRFDCQFLMAT 401
                    |||||:...|..||.|.|        ||...:||.|.:|||||||:||.|...    
plant   359 --------SLFSSVAFGFLNFFGSVFGDLTESMIKRDAGVKDSGSLIPGHGGILDRVDSYI---- 411

  Fly   402 FVNVYISSFIRT 413
            |......|||:|
plant   412 FTGALAYSFIKT 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CdsNP_001286976.1 CTP_transf_1 120..438 CDD:304393 79/308 (26%)
CDS4NP_566035.2 PLN02953 40..430 CDD:178539 85/337 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0575
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072976at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X636
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.