DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wb and alp7

DIOPT Version :9

Sequence 1:NP_723870.1 Gene:wb / 43946 FlyBaseID:FBgn0261563 Length:3375 Species:Drosophila melanogaster
Sequence 2:NP_594820.1 Gene:alp7 / 2543382 PomBaseID:SPAC890.02c Length:474 Species:Schizosaccharomyces pombe


Alignment Length:413 Identity:83/413 - (20%)
Similarity:137/413 - (33%) Gaps:158/413 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IASSPDKKKKSPQSSR----------RHKTKSGLIIESNI-----ADSESMLAIASSESVTKKKP 115
            ::||.|..::||.||.          .|:.:.|...||.|     :..|||.|......:|.|..
pombe     5 VSSSTDYSRRSPSSSSIGTNETDHTGFHEKRQGASSESLIPPAQRSSEESMPAPKLFPKLTSKPN 69

  Fly   116 PQ--------RRRNGKLQKSGGGAGGGALRLLKTEDVYSSSFSGGLYPPLFNVVPRAQISVNATC 172
            ||        :|.:.:||         ||.|.|:.|     |||         .||....::...
pombe    70 PQLNLKDTLNKRVSDRLQ---------ALELNKSFD-----FSG---------TPRPMHPISHPL 111

  Fly   173 GQNGAEEYCKQVGAKPCGICNAHSSDRAKQRSIQSLI---------SSGSGSGSG------SGFE 222
            .|:...|:                  :.::|:::|::         ||.:.|..|      |.|.
pombe   112 SQHKTPEF------------------KHRKRNVESILTPKNPSLFSSSNAASQRGSLNTAPSNFA 158

  Fly   223 EGWWQS---------PTLQGGRQFEYVTILLDLKQTFQIFSVWLKS--ANSPRPASWILEKSLDG 276
            .....|         |.|..| .|...|....|..     .|.||.  .||..|::         
pombe   159 YSHSSSLQTSASSRPPVLSNG-SFPRQTNTAPLNP-----PVHLKDNIRNSATPST--------- 208

  Fly   277 INFEPWQYFGLSDADCQRRWNLSG---QNGKYVFQNDTEI------ICSTQFSKPGPLENGVLHA 332
                       |.||...::.::.   |..||    :.||      :..| :.:...|:|.:::.
pombe   209 -----------SQADIPTQYPINSTQKQQAKY----EAEIEGYKAKLAGT-YHEISVLQNTIVNV 257

  Fly   333 S---------LLKNRPGATDQSPELMKFITTRYIRIRL------------QGMHSTANQDNSLDW 376
            |         |.:.|.|....||      :|:...:||            :|.::....|..:..
pombe   258 SGQLIAVNDQLQQLRSGKASTSP------STKDTNMRLVEGHNEETLALQRGKYTQEEVDKLIQE 316

  Fly   377 LLDSPSLEKHSFYSLSQL-KVSA 398
            .::..:.:.|:.||.... |::|
pombe   317 RMEKVAEDLHAQYSAKHTQKINA 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wbNP_723870.1 Laminin_N 164..396 CDD:278484 48/288 (17%)
EGF_Lam 401..450 CDD:238012
TNFRSF <407..507 CDD:304602
EGF_Lam 505..552 CDD:238012
Laminin_EGF 550..597 CDD:278482
Laminin_B 660..798 CDD:278481
EGF_Lam 851..900 CDD:238012
Laminin_EGF <943..971 CDD:278482
VSP 953..1414 CDD:146106
Laminin_EGF 974..1018 CDD:278482
EGF_Lam 1017..1065 CDD:238012
Laminin_EGF 1065..>1105 CDD:278482
EGF_Lam 1150..1197 CDD:238012
Laminin_EGF 1199..1247 CDD:278482
EGF_Lam 1247..1292 CDD:238012
Laminin_EGF 1294..1342 CDD:278482
Laminin_EGF 1340..1392 CDD:278482
Laminin_B 1486..1611 CDD:278481
EGF_Lam 1669..1716 CDD:238012
Laminin_EGF 1718..1767 CDD:278482
EGF_Lam 1772..1819 CDD:238012
CrfC <1933..2267 CDD:223771
Laminin_II 2277..2400 CDD:283628
LamG 2399..>2492 CDD:304605
Laminin_G_2 2616..2755 CDD:280389
Laminin_G_2 2804..2944 CDD:280389
Laminin_G_2 3038..3169 CDD:280389
LamG 3192..3347 CDD:238058
alp7NP_594820.1 Kinetocho_Slk19 316..407 CDD:289479 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100395
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.