DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and APS2

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_012592.1 Gene:APS2 / 853521 SGDID:S000003819 Length:147 Species:Saccharomyces cerevisiae


Alignment Length:143 Identity:52/143 - (36%)
Similarity:79/143 - (55%) Gaps:8/143 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKAILVFNNHGKPRLSKFYQYF--DESLQQQIIKETFQLVSKRD-DNVCNFLEGGSLIGGSDYKL 63
            ::.||.||..|..||.:::...  |....|..|.:.::|:|.|| .:..||:|     .....||
Yeast     3 VQFILCFNKQGVVRLVRWFDVHSSDPQRSQDAIAQIYRLISSRDHKHQSNFVE-----FSDSTKL 62

  Fly    64 IYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGM 128
            |||.||.||||..||..:.|...|..|.:|||.||..|.||||||::|:...|:.|:.|:.:||.
Yeast    63 IYRRYAGLYFVMGVDLLDDEPIYLCHIHLFVEVLDAFFGNVCELDIVFNFYKVYMIMDEMFIGGE 127

  Fly   129 VLQTNMNDIMARI 141
            :.:.:.:.::.|:
Yeast   128 IQEISKDMLLERL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 52/143 (36%)
APS2NP_012592.1 longin-like 3..146 CDD:365781 52/143 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.