DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and APS3

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_012510.3 Gene:APS3 / 853429 SGDID:S000003561 Length:194 Species:Saccharomyces cerevisiae


Alignment Length:158 Identity:71/158 - (44%)
Similarity:102/158 - (64%) Gaps:12/158 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRD-DNVCNFL-----------EGG 53
            ||.|:|:||...:|||.|||...|...|:.::::.::|:|:|: |...:||           ...
Yeast     1 MIHAVLIFNKKCQPRLVKFYTPVDLPKQKLLLEQVYELISQRNSDFQSSFLVTPPSLLLSNENNN 65

  Fly    54 SLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHH 118
            ..:...|.::||::||||||.|.||..||||.||||||.|||:||:||..|.||||||:...:..
Yeast    66 DEVNNEDIQIIYKNYATLYFTFIVDDQESELAILDLIQTFVESLDRCFTEVNELDLIFNWQTLES 130

  Fly   119 ILSELVMGGMVLQTNMNDIMARIEEQNK 146
            :|.|:|.||||::||:|.|:|.::|.||
Yeast   131 VLEEIVQGGMVIETNVNRIVASVDELNK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 69/156 (44%)
APS3NP_012510.3 APS2 1..172 CDD:227363 71/158 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344137
Domainoid 1 1.000 136 1.000 Domainoid score I1080
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I1213
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoFinder 1 1.000 - - FOG0002758
OrthoInspector 1 1.000 - - oto98984
orthoMCL 1 0.900 - - OOG6_102376
Panther 1 1.100 - - LDO PTHR11753
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R65
SonicParanoid 1 1.000 - - X1844
TreeFam 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.