DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and ap1s3

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001016579.1 Gene:ap1s3 / 549333 XenbaseID:XB-GENE-973129 Length:154 Species:Xenopus tropicalis


Alignment Length:147 Identity:49/147 - (33%)
Similarity:89/147 - (60%) Gaps:6/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            ||:.:|:|:..||.||.|:|....:..:.:|.:|...::..|:..:.:|::      ..|.||:|
 Frog     1 MIRFLLLFSRQGKLRLQKWYVTLPDKEKHKISRELVHIILSRNPKMSSFVD------WKDLKLVY 59

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            :.||:|||...::..::||..|:|:..|||.|||.|.||||||:||:.:..:.:|.|.:|||.:.
 Frog    60 KRYASLYFCCAIEDQDNELLALELVHRFVELLDKYFGNVCELDIIFNFEKAYFLLDEFLMGGEIQ 124

  Fly   131 QTNMNDIMARIEEQNKI 147
            :|:.:.::...|:.:.:
 Frog   125 ETSKDSVVRATEDSDML 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 49/144 (34%)
ap1s3NP_001016579.1 AP1_sigma 3..143 CDD:341435 47/145 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.