DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and ap3s2

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001011184.1 Gene:ap3s2 / 496606 XenbaseID:XB-GENE-5734699 Length:193 Species:Xenopus tropicalis


Alignment Length:182 Identity:141/182 - (77%)
Similarity:163/182 - (89%) Gaps:0/182 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            |||||||||||||||..:|||:|.|..||||::|||.||||||||||||||||||||||||||||
 Frog     1 MIKAILVFNNHGKPRFLRFYQHFPEDTQQQIVRETFHLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            ||||||||||||||||||||||||||||||||||||||||||||||:.|.||:||.|:|||||||
 Frog    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFNVDKVHYILHEMVMGGMVL 130

  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAPARAVSAVKSMNIPQQIKDIKLPDL 182
            :|||::::.::|.|:|:.|.|||.||||||||||:|:||:|...::|.:.||
 Frog   131 ETNMSEVITQVEAQSKLEKSEAGFSAAPARAVSAMKNMNLPDLPRNINIGDL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 119/144 (83%)
ap3s2NP_001011184.1 AP3_sigma 1..146 CDD:341438 119/144 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 254 1.000 Domainoid score I2020
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H100592
Inparanoid 1 1.050 294 1.000 Inparanoid score I2714
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458249at2759
OrthoFinder 1 1.000 - - FOG0002758
OrthoInspector 1 1.000 - - oto102307
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R65
SonicParanoid 1 1.000 - - X1844
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.