DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and arpin

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001004898.1 Gene:arpin / 448248 XenbaseID:XB-GENE-941490 Length:226 Species:Xenopus tropicalis


Alignment Length:37 Identity:10/37 - (27%)
Similarity:15/37 - (40%) Gaps:13/37 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VDSSESELG-------------ILDLIQVFVETLDKC 100
            |:.:|.|||             :..|.:|...|:.||
 Frog   147 VEKTELELGEQLRVKTMGDSPFVFSLAKVDSGTVTKC 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 10/37 (27%)
arpinNP_001004898.1 UPF0552 1..225 CDD:371144 10/37 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..226
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458249at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.