powered by:
Protein Alignment or and arpin
DIOPT Version :9
Sequence 1: | NP_536793.1 |
Gene: | or / 43943 |
FlyBaseID: | FBgn0003008 |
Length: | 191 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001004898.1 |
Gene: | arpin / 448248 |
XenbaseID: | XB-GENE-941490 |
Length: | 226 |
Species: | Xenopus tropicalis |
Alignment Length: | 37 |
Identity: | 10/37 - (27%) |
Similarity: | 15/37 - (40%) |
Gaps: | 13/37 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 VDSSESELG-------------ILDLIQVFVETLDKC 100
|:.:|.||| :..|.:|...|:.||
Frog 147 VEKTELELGEQLRVKTMGDSPFVFSLAKVDSGTVTKC 183
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1458249at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.