DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and ap3s2

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001002539.1 Gene:ap3s2 / 436812 ZFINID:ZDB-GENE-040718-274 Length:192 Species:Danio rerio


Alignment Length:182 Identity:146/182 - (80%)
Similarity:167/182 - (91%) Gaps:0/182 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            ||||||:|||||||||.:|||||.|.:|||||:|||.||||||||||||||||||||||||||||
Zfish     1 MIKAILIFNNHGKPRLIRFYQYFAEDMQQQIIRETFHLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            |||||||||||||||||||||||||||||||||||||||||||||||.|.||:||.|:|||||||
Zfish    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVL 130

  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAPARAVSAVKSMNIPQQIKDIKLPDL 182
            :||||:|:|::|.||::.|.|.|:||||||||||||:||:|:..::|.:.|:
Zfish   131 ETNMNEIVAQVELQNRMEKSEGGLSAAPARAVSAVKNMNLPEIPRNINIGDI 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 125/144 (87%)
ap3s2NP_001002539.1 AP3_sigma 1..146 CDD:341438 125/144 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581940
Domainoid 1 1.000 265 1.000 Domainoid score I1866
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100592
Inparanoid 1 1.050 304 1.000 Inparanoid score I2644
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1458249at2759
OrthoFinder 1 1.000 - - FOG0002758
OrthoInspector 1 1.000 - - oto38646
orthoMCL 1 0.900 - - OOG6_102376
Panther 1 1.100 - - LDO PTHR11753
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R65
SonicParanoid 1 1.000 - - X1844
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.