DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and ap4s1

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_005158818.1 Gene:ap4s1 / 368852 ZFINID:ZDB-GENE-030616-404 Length:144 Species:Danio rerio


Alignment Length:153 Identity:58/153 - (37%)
Similarity:94/153 - (61%) Gaps:14/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFD----ESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDY 61
            |||.:|:.|..|:.||||:|:..|    .:|:..:::..  |..::::  |:|:|      ..||
Zfish     1 MIKFLLMVNKQGQTRLSKYYEAVDLGKRAALEADVVRGC--LARRKEE--CSFVE------YKDY 55

  Fly    62 KLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMG 126
            ||:||.||.|:.|..|..:|:||.|.:|:..|||.|||.|..|.|||::|:.|.||.||.|:::.
Zfish    56 KLVYRQYAALFIVVGVTENENELSIYELVHNFVEVLDKYFSRVSELDIMFNLDKVHIILDEMILN 120

  Fly   127 GMVLQTNMNDIMARIEEQNKIVK 149
            |.:::||.|.|:|.:...:|:.:
Zfish   121 GHIVETNKNRILAPLLALDKMTE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 57/148 (39%)
ap4s1XP_005158818.1 APS2 1..143 CDD:227363 58/151 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.