DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and Ap1s3

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_038939904.1 Gene:Ap1s3 / 367304 RGDID:1311772 Length:178 Species:Rattus norvegicus


Alignment Length:146 Identity:50/146 - (34%)
Similarity:86/146 - (58%) Gaps:6/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIYR 66
            |..||:|:..||.||.|:|....:..:::|.:|..|.|..|.....:|::...|      ||:|:
  Rat    26 IHFILLFSRQGKLRLQKWYTTLPDKERKKITREIIQTVLSRGHRTSSFIDWKEL------KLVYK 84

  Fly    67 HYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVLQ 131
            .||:|||...:::.::||..|:::..:||.|||.|.||||||:||:.:..:.||.|.::||.:.:
  Rat    85 RYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIGGEIQE 149

  Fly   132 TNMNDIMARIEEQNKI 147
            |:....:..||:.:.:
  Rat   150 TSKKTAVKAIEDSDML 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 50/143 (35%)
Ap1s3XP_038939904.1 AP1_sigma 27..167 CDD:341435 49/145 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.