DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and Ap1s2

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_006256922.1 Gene:Ap1s2 / 302671 RGDID:1561862 Length:160 Species:Rattus norvegicus


Alignment Length:158 Identity:56/158 - (35%)
Similarity:94/158 - (59%) Gaps:8/158 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIYRHYA 69
            :|:|:..||.||.|:|....:..:::|.:|..|.|..|...:|:|||      ..|.|::|:.||
  Rat     4 MLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLE------WRDLKIVYKRYA 62

  Fly    70 TLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVLQTNM 134
            :|||...::..::||..|::|..:||.|||.|.:|||||:||:.:..:.||.|.::||.|.:|:.
  Rat    63 SLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSK 127

  Fly   135 NDIMARIEEQNKIVKQEAGISAAPARAV 162
            .:::..||:.:.:  ||....|...|:|
  Rat   128 KNVLKAIEQADLL--QEDAKEAETPRSV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 51/140 (36%)
Ap1s2XP_006256922.1 AP1_sigma 2..144 CDD:341435 53/147 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.