DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and Ap3s1

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_006254755.1 Gene:Ap3s1 / 302290 RGDID:1311115 Length:209 Species:Rattus norvegicus


Alignment Length:206 Identity:147/206 - (71%)
Similarity:167/206 - (81%) Gaps:23/206 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            ||||||:||||||||||||||.:.|..|||||:|||.||||||:|||||||||.||||||.||||
  Rat     1 MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIY 65

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            |||||||||||||||||||||||||||||||||||||||||||||||.|.||:||:|:|||||||
  Rat    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVL 130

  Fly   131 QTNMNDIMARIEEQNKIVKQE----------------AGISAAPARAVSAVKSMNIPQ-----QI 174
            :||||:|:.:|:.|||:.|.|                ||::.||||||||||:||:|:     .|
  Rat   131 ETNMNEIVTQIDAQNKLEKSEQIVYTGLFCISQDFSQAGLAGAPARAVSAVKNMNLPEIPRNINI 195

  Fly   175 KD--IKLPDLP 183
            .|  ||:|:||
  Rat   196 GDISIKVPNLP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 121/144 (84%)
Ap3s1XP_006254755.1 AP3_sigma 1..146 CDD:341438 121/144 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341904
Domainoid 1 1.000 255 1.000 Domainoid score I1966
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1458249at2759
OrthoFinder 1 1.000 - - FOG0002758
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102376
Panther 1 1.100 - - O PTHR11753
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1844
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.