DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and vas2

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_593410.1 Gene:vas2 / 2542885 PomBaseID:SPAP27G11.06c Length:162 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:50/143 - (34%)
Similarity:88/143 - (61%) Gaps:12/143 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDY---KL 63
            ||..|:.:..||.||:|::.......:.:||::...||..|...:|||:|         |   |:
pombe     3 IKFFLLVSRQGKVRLAKWFNTLSIKERAKIIRDVSSLVITRKPKMCNFVE---------YKGEKI 58

  Fly    64 IYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGM 128
            :||.||:|:||..::..::||.||::|..|||.|||.|.|||||||||:.:..::::.||::.|.
pombe    59 VYRRYASLFFVCGIEQDDNELIILEVIHKFVECLDKYFGNVCELDLIFNFEKAYYVMEELLLAGE 123

  Fly   129 VLQTNMNDIMARI 141
            :.:::..::::.:
pombe   124 LQESSKTNVLSAV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 50/143 (35%)
vas2NP_593410.1 APS2 2..153 CDD:227363 50/143 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.