DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and aps-3

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001380048.1 Gene:aps-3 / 171691 WormBaseID:WBGene00000165 Length:192 Species:Caenorhabditis elegans


Alignment Length:183 Identity:153/183 - (83%)
Similarity:171/183 - (93%) Gaps:0/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            |||||||.||||||||.||||::.|..||||::||||||||||||||||||||:||.|:||:|||
 Worm     1 MIKAILVINNHGKPRLLKFYQHYPEEKQQQIVRETFQLVSKRDDNVCNFLEGGTLIDGNDYRLIY 65

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            ||||||||:||||||||||||||||||||||||:|||||||||||||.|.|||||.|:|||||||
 Worm    66 RHYATLYFIFCVDSSESELGILDLIQVFVETLDRCFENVCELDLIFHVDRVHHILGEIVMGGMVL 130

  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAPARAVSAVKSMNIPQQIKDIKLPDLP 183
            :||||:|:.||:||:||.||||||:|||||||||||:|||.||:|||||||||
 Worm   131 ETNMNEILQRIQEQDKIQKQEAGITAAPARAVSAVKNMNISQQLKDIKLPDLP 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 120/144 (83%)
aps-3NP_001380048.1 AP3_sigma 1..146 CDD:341438 120/144 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159965
Domainoid 1 1.000 257 1.000 Domainoid score I1083
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100592
Inparanoid 1 1.050 318 1.000 Inparanoid score I1512
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1458249at2759
OrthoFinder 1 1.000 - - FOG0002758
OrthoInspector 1 1.000 - - oto20555
orthoMCL 1 0.900 - - OOG6_102376
Panther 1 1.100 - - LDO PTHR11753
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R65
SonicParanoid 1 1.000 - - X1844
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.