DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and AP3S1

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_016864514.1 Gene:AP3S1 / 1176 HGNCID:2013 Length:238 Species:Homo sapiens


Alignment Length:158 Identity:105/158 - (66%)
Similarity:119/158 - (75%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            ||||||:||||||||||||||.:.|..|||||:|||.||||||:|||||||||.||||||.||||
Human   101 MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIY 165

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            ||||||||||||||||||||||||||                        ||:||:|:|||||||
Human   166 RHYATLYFVFCVDSSESELGILDLIQ------------------------VHNILAEMVMGGMVL 206

  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAP 158
            :||||:|:.:|:.|||:.|.|..|..:|
Human   207 ETNMNEIVTQIDAQNKLEKSETFIFQSP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 99/144 (69%)
AP3S1XP_016864514.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148030
Domainoid 1 1.000 44 1.000 Domainoid score I12310
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 297 1.000 Inparanoid score I2735
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1458249at2759
OrthoFinder 1 1.000 - - FOG0002758
OrthoInspector 1 1.000 - - otm40337
orthoMCL 1 0.900 - - OOG6_102376
Panther 1 1.100 - - O PTHR11753
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R65
SonicParanoid 1 1.000 - - X1844
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.