DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cl and Nxnl2

DIOPT Version :9

Sequence 1:NP_001260098.1 Gene:cl / 43938 FlyBaseID:FBgn0000318 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001163900.1 Gene:Nxnl2 / 689232 RGDID:1594820 Length:156 Species:Rattus norvegicus


Alignment Length:81 Identity:19/81 - (23%)
Similarity:33/81 - (40%) Gaps:12/81 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LENGDEPVHVLFSGGKDEKGESWCP-YCVKAEPVIHDALKKAPGNSHFVHVDVGERA---YWKDL 80
            |:|  :.|.:.|:.|:......:.| .|.....::.:|.:.||....||..|.....   :.::|
  Rat    24 LQN--KVVALYFAAGRCAPSRDFTPLLCDFYTELVSEARRPAPFEVVFVSADRSAEEMLDFMREL 86

  Fly    81 N-----CPFRKDPNTH 91
            :     .||. ||..|
  Rat    87 HGSWLALPFH-DPYRH 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clNP_001260098.1 DUF953 6..124 CDD:368751 19/81 (23%)
Nxnl2NP_001163900.1 TryX_like_family 10..144 CDD:239262 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.