DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cl and nxnl1

DIOPT Version :9

Sequence 1:NP_001260098.1 Gene:cl / 43938 FlyBaseID:FBgn0000318 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001104230.1 Gene:nxnl1 / 567911 ZFINID:ZDB-GENE-070424-115 Length:215 Species:Danio rerio


Alignment Length:136 Identity:33/136 - (24%)
Similarity:49/136 - (36%) Gaps:36/136 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VVTHNVKGYDEFTKKMEELENGDEPVHVLFSG-GKDEKGESWCPYCVKAEPVIHDALKKAPGNSH 65
            |:..|.|..||...:.|.:......:.:||.| |..||       |....|.:.|..||.....:
Zfish     9 VLVKNNKDRDELDTEREIILRLQNRILMLFFGSGDSEK-------CQDFAPTLKDFYKKLTDEFY 66

  Fly    66 ----------FVHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLRWKRPQRLDGERCSNQDLVEM 120
                      ::.:|..|....|     |.|:.....:|||    ::.|.|        |:| .:
Zfish    67 VERSAQLVLLYISLDSSEEQQEK-----FLKELPKRCLFLP----YEDPYR--------QEL-GV 113

  Fly   121 MFEDED 126
            |||..|
Zfish   114 MFEVRD 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clNP_001260098.1 DUF953 6..124 CDD:368751 30/128 (23%)
nxnl1NP_001104230.1 Thioredoxin_like 8..153 CDD:294274 33/136 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..215
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.