DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cl and Txndc17

DIOPT Version :9

Sequence 1:NP_001260098.1 Gene:cl / 43938 FlyBaseID:FBgn0000318 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_080835.1 Gene:Txndc17 / 52700 MGIID:1289248 Length:123 Species:Mus musculus


Alignment Length:120 Identity:49/120 - (40%)
Similarity:74/120 - (61%) Gaps:4/120 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NVKGYDEFTKKMEELENGDEPVHVLFSGGKDEKGESWCPYCVKAEPVIHDALKKAPGNSHFVHVD 70
            :|.|::||.|.::|.|.  :.:...|||.||.:|:||||.||:|||||.:.||....:..|::..
Mouse     8 SVLGFEEFDKAVKEHEG--KTIFAYFSGSKDTEGKSWCPDCVEAEPVIREGLKHVTEDCVFIYCQ 70

  Fly    71 VGERAYWKDLNCPFRKDPNTHLIFLPTLLRWKRPQRLDGERCSNQDLVEMMFEDE 125
            ||::.||||.|..||:  ...:..:||||::..||:|....|....||||:|.::
Mouse    71 VGDKPYWKDPNNDFRQ--KLKITAVPTLLKYGTPQKLVESECCQSSLVEMIFSED 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clNP_001260098.1 DUF953 6..124 CDD:368751 49/117 (42%)
Txndc17NP_080835.1 TRP14_like 4..121 CDD:239250 48/116 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843203
Domainoid 1 1.000 99 1.000 Domainoid score I7106
eggNOG 1 0.900 - - E1_KOG3425
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41683
Inparanoid 1 1.050 100 1.000 Inparanoid score I4980
Isobase 1 0.950 - 0 Normalized mean entropy S4110
OMA 1 1.010 - - QHG52861
OrthoDB 1 1.010 - - D1624076at2759
OrthoFinder 1 1.000 - - FOG0003910
OrthoInspector 1 1.000 - - oto93906
orthoMCL 1 0.900 - - OOG6_103445
Panther 1 1.100 - - O PTHR12452
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1991
SonicParanoid 1 1.000 - - X3213
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.