DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cl and CG3939

DIOPT Version :9

Sequence 1:NP_001260098.1 Gene:cl / 43938 FlyBaseID:FBgn0000318 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001284837.1 Gene:CG3939 / 31295 FlyBaseID:FBgn0040396 Length:135 Species:Drosophila melanogaster


Alignment Length:120 Identity:47/120 - (39%)
Similarity:69/120 - (57%) Gaps:2/120 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KGYDEFTKKMEELENGDEPVHVLFSGGKDEKGESWCPYCVKAEPVIHDALKK-APGNSHFVHVDV 71
            :|:.|....::..||...|:::.|.|.||:.|.||||.||.||..|..|.:. ||.:...:.|||
  Fly     8 RGFKEMENLIKLYENQRSPIYIYFYGEKDKDGRSWCPDCVAAEETIMSAFRNHAPADCMILVVDV 72

  Fly    72 GERAYWKDLNCPFRKDPNTHLIFLPTLLRWKRPQRLDGERCSNQDLVEMMFEDED 126
            |.|..|...:..|||.|.: :..:|||:|||..:||||::.....|:|:.||:.|
  Fly    73 GSRESWIGKDNMFRKPPYS-VEGIPTLIRWKGVERLDGDQLLKSSLLELFFEETD 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clNP_001260098.1 DUF953 6..124 CDD:368751 45/116 (39%)
CG3939NP_001284837.1 DUF953 6..124 CDD:283713 45/116 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458010
Domainoid 1 1.000 61 1.000 Domainoid score I3813
eggNOG 1 0.900 - - E1_KOG3425
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I2542
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D125802at33392
OrthoFinder 1 1.000 - - FOG0003910
OrthoInspector 1 1.000 - - otm3466
orthoMCL 1 0.900 - - OOG6_103445
Panther 1 1.100 - - P PTHR12452
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3213
1110.800

Return to query results.
Submit another query.