DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cl and Txndc17

DIOPT Version :10

Sequence 1:NP_608930.1 Gene:cl / 43938 FlyBaseID:FBgn0000318 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001099275.1 Gene:Txndc17 / 287474 RGDID:1308868 Length:123 Species:Rattus norvegicus


Alignment Length:120 Identity:47/120 - (39%)
Similarity:75/120 - (62%) Gaps:4/120 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NVKGYDEFTKKMEELENGDEPVHVLFSGGKDEKGESWCPYCVKAEPVIHDALKKAPGNSHFVHVD 70
            :|.|::||.|.::|.:.  :.:...|||.||.:|:||||.||:|||:|.:.||....:..|::..
  Rat     8 SVLGFEEFDKAVKEHQG--KTIFAFFSGSKDTEGKSWCPDCVEAEPIIREGLKHVTEDCVFIYCQ 70

  Fly    71 VGERAYWKDLNCPFRKDPNTHLIFLPTLLRWKRPQRLDGERCSNQDLVEMMFEDE 125
            ||::.||||.|..||:  ...:..:||||::..||:|....|...:||||:|.::
  Rat    71 VGDKPYWKDPNNDFRQ--KLKITAVPTLLKYGTPQKLVESECRQSNLVEMIFSED 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clNP_608930.1 DUF953 6..124 CDD:399247 47/117 (40%)
Txndc17NP_001099275.1 TRP14_like 4..121 CDD:239250 46/116 (40%)

Return to query results.
Submit another query.