DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cl and Txndc17

DIOPT Version :9

Sequence 1:NP_001260098.1 Gene:cl / 43938 FlyBaseID:FBgn0000318 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001099275.1 Gene:Txndc17 / 287474 RGDID:1308868 Length:123 Species:Rattus norvegicus


Alignment Length:120 Identity:47/120 - (39%)
Similarity:75/120 - (62%) Gaps:4/120 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NVKGYDEFTKKMEELENGDEPVHVLFSGGKDEKGESWCPYCVKAEPVIHDALKKAPGNSHFVHVD 70
            :|.|::||.|.::|.:.  :.:...|||.||.:|:||||.||:|||:|.:.||....:..|::..
  Rat     8 SVLGFEEFDKAVKEHQG--KTIFAFFSGSKDTEGKSWCPDCVEAEPIIREGLKHVTEDCVFIYCQ 70

  Fly    71 VGERAYWKDLNCPFRKDPNTHLIFLPTLLRWKRPQRLDGERCSNQDLVEMMFEDE 125
            ||::.||||.|..||:  ...:..:||||::..||:|....|...:||||:|.::
  Rat    71 VGDKPYWKDPNNDFRQ--KLKITAVPTLLKYGTPQKLVESECRQSNLVEMIFSED 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clNP_001260098.1 DUF953 6..124 CDD:368751 47/117 (40%)
Txndc17NP_001099275.1 TRP14_like 4..121 CDD:239250 46/116 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346708
Domainoid 1 1.000 98 1.000 Domainoid score I7026
eggNOG 1 0.900 - - E1_KOG3425
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41683
Inparanoid 1 1.050 99 1.000 Inparanoid score I4915
OMA 1 1.010 - - QHG52861
OrthoDB 1 1.010 - - D1624076at2759
OrthoFinder 1 1.000 - - FOG0003910
OrthoInspector 1 1.000 - - oto97441
orthoMCL 1 0.900 - - OOG6_103445
Panther 1 1.100 - - O PTHR12452
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3213
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.