DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cl and txdc-17

DIOPT Version :9

Sequence 1:NP_001260098.1 Gene:cl / 43938 FlyBaseID:FBgn0000318 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_497626.1 Gene:txdc-17 / 175400 WormBaseID:WBGene00022188 Length:132 Species:Caenorhabditis elegans


Alignment Length:127 Identity:49/127 - (38%)
Similarity:70/127 - (55%) Gaps:6/127 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HNVKGYDEFTKKMEELENGDEPVHVLFSGGKD-EKGESWCPYCVKAEPVIHDALKKAPG---NSH 65
            :..:||:.|.:.::.:..|...| .||:|.|. ..||||||.||.||||:.:.:|.|..   :.|
 Worm     7 YTAQGYEAFQETLKSIGKGKRVV-ALFTGSKILTTGESWCPDCVVAEPVVEEVIKDAAVAGLDVH 70

  Fly    66 FVHVDVGERAYWKDLNCPFRKDPNTHLIFLPTLLR-WKRPQRLDGERCSNQDLVEMMFEDED 126
            ||.|.||.|..|:|....||.||...|..:||||. ..:.:||...:.:|:.||:..|.:||
 Worm    71 FVTVFVGNREVWRDPAVGFRTDPTLKLTCIPTLLEVGNKAKRLLERQIANKHLVKDFFTEED 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clNP_001260098.1 DUF953 6..124 CDD:368751 47/122 (39%)
txdc-17NP_497626.1 Thioredoxin_like 8..130 CDD:381987 47/122 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162753
Domainoid 1 1.000 76 1.000 Domainoid score I5816
eggNOG 1 0.900 - - E1_KOG3425
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I3782
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52861
OrthoDB 1 1.010 - - D1624076at2759
OrthoFinder 1 1.000 - - FOG0003910
OrthoInspector 1 1.000 - - otm14769
orthoMCL 1 0.900 - - OOG6_103445
Panther 1 1.100 - - O PTHR12452
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1991
SonicParanoid 1 1.000 - - X3213
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.