DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cl and T05F1.11

DIOPT Version :9

Sequence 1:NP_001260098.1 Gene:cl / 43938 FlyBaseID:FBgn0000318 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_492564.2 Gene:T05F1.11 / 172811 WormBaseID:WBGene00011495 Length:676 Species:Caenorhabditis elegans


Alignment Length:123 Identity:26/123 - (21%)
Similarity:41/123 - (33%) Gaps:37/123 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EFTKKMEELEN----GDEPV--HVLFSGGKDEK-----------GESWCPYCVKAEPVIHDALKK 59
            |.|.|||::.|    .:.|:  |:..||...|:           ...||.......|::.....:
 Worm   522 EETNKMEQMNNCTFLQNVPLFRHLHPSGSYSERMLDGKVIGLYYSGYWCQPSRDFTPILAQFYSQ 586

  Fly    60 APGNSH--FVHVDVGERAY----------WKDLNCPFRKDPNTHL------IFLPTLL 99
            ...|..  |:..|..|:..          |  .:.||....:.||      ..:|||:
 Worm   587 VDKNFEILFISSDRSEQEMNYYLQSSHGDW--FHLPFDSPISKHLQQFNTKNAIPTLI 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
clNP_001260098.1 DUF953 6..124 CDD:368751 26/123 (21%)
T05F1.11NP_492564.2 tolA_full <457..>522 CDD:274303 26/123 (21%)
Thioredoxin_like 556..661 CDD:381987 15/89 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.