DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and Htr3a

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_006243083.1 Gene:Htr3a / 79246 RGDID:61818 Length:488 Species:Rattus norvegicus


Alignment Length:329 Identity:67/329 - (20%)
Similarity:116/329 - (35%) Gaps:80/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 LAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQ 312
            |..::.:.:|.|.:.....|.|..|.|.||||.::.....|...||.|  ::|......:|:...
  Rat    76 LNVDEKNQVLTTYIWYRQFWTDEFLQWTPEDFDNVTKLSIPTDSIWVP--DILINEFVDVGKSPS 138

  Fly   313 SYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPI 377
            ...:.|:..|.:..| :.|||.:.|.....|:|.:...|.:                        
  Rat   139 IPYVYVHHQGEVQNY-KPLQLVTACSLDIYNFPFDVQNCSL------------------------ 178

  Fly   378 APNEHVNTPSGWSFTQMSVVL--------VEND-----SQRRYNPKGMMQKMTGDVAIEFTLQRN 429
                   |.:.|..|...:.:        |.:|     :|..:...|:..|..     ||:::.:
  Rat   179 -------TFTSWLHTIQDINISLWRTPEEVRSDKSIFINQGEWELLGVFTKFQ-----EFSIETS 231

  Fly   430 RS-----FYMTV-----FY-----LPLIACQMFLILSFVL---RSTRRSSLILIALLIAAWGLMY 476
            .|     ||:.:     ||     ||.|...:..|:.|.|   ...|.|..|.:.|..:.:.::.
  Rat   232 NSYAEMKFYVVIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIV 296

  Fly   477 MTRYASPHYVPPMMTAYKVIMMTTTYCYILH-ICIIWL----DLYPPRSKAPGWLVRVINSNV-- 534
            .....:.....|::..|.|:.|......:.. |.|:.|    ||..|   .|.||..::...:  
  Rat   297 SDTLPATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRP---VPDWLRHLVLDRIAW 358

  Fly   535 LRCI 538
            |.|:
  Rat   359 LLCL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 37/193 (19%)
Htr3aXP_006243083.1 LIC 5..482 CDD:273305 67/329 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.