DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and chrna2a

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001035417.1 Gene:chrna2a / 678575 ZFINID:ZDB-GENE-040108-2 Length:520 Species:Danio rerio


Alignment Length:334 Identity:67/334 - (20%)
Similarity:130/334 - (38%) Gaps:31/334 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EKLLSHLNIQAENASMPA-NLSS---ISFHFQTRSLA-YEQTSSLLQTRMHMMMHWRDSRLVWKP 276
            :||...|.|.....|.|. |:|.   :.|......|. .::.:.::.|.:.:...|.|.:|.|.|
Zfish    38 DKLFHKLFIGYNKWSRPVRNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNP 102

  Fly   277 EDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSA 341
            .:|.::.|...|...||.|.:.:.|.| .....|....:..::..|.::.....:..:|..:| .
Zfish   103 SEFDNVTSIRVPSEMIWVPDIVLYNNA-DGEFAVTHMTKAHLFHTGKVSWVPPAIYKSSCSID-V 165

  Fly   342 RNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNE-HVNTPSGWSFTQMSVVLVENDSQR 405
            ..:|.::..|.::.|          :..||..:..:...| .|:....|...:.:::    ::..
Zfish   166 TFFPFDQQNCKMKFG----------SWTYDKAKIDLEQIEGTVDLKDYWESGEWAII----NAVG 216

  Fly   406 RYNPK--GMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRST--RRSSLILIA 466
            .||.|  ....::..|:...|.::|...||.....:|.:......:|.|.|.|.  .:.:|.:..
Zfish   217 TYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISV 281

  Fly   467 LLIAAWGLMYMTR-YASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLY---PPRSKAPGWLV 527
            ||.....|:.:|. ..|...|.|::..|.:..|......|: |.:..|:::   |.....|.|:.
Zfish   282 LLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIV-ITVFVLNVHHRSPSTHSMPRWVH 345

  Fly   528 RVINSNVLR 536
            .|...::.|
Zfish   346 SVFLDHIPR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 41/219 (19%)
chrna2aNP_001035417.1 LIC 9..513 CDD:273305 67/334 (20%)
Neur_chan_LBD 37..243 CDD:280998 42/220 (19%)
Neur_chan_memb 250..511 CDD:280999 23/106 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.