Sequence 1: | NP_651958.2 | Gene: | NtR / 43935 | FlyBaseID: | FBgn0029147 | Length: | 585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_071525.1 | Gene: | Htr3b / 58963 | RGDID: | 61820 | Length: | 437 | Species: | Rattus norvegicus |
Alignment Length: | 270 | Identity: | 63/270 - (23%) |
---|---|---|---|
Similarity: | 94/270 - (34%) | Gaps: | 78/270 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 257 LQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYEL-MVYA 320
Fly 321 NGSITLYAQN-LQLASWCVDSARNWPSERVTC------------DIELG-LNGQEGQENVALIYD 371
Fly 372 DQRKPIAPNE----------HVNTPSGWSFTQM--------------------SVVLVENDSQRR 406
Fly 407 YNPKGMMQKMT--GDVAIEFTLQR-------NRSFYMT----VFYLPLIACQMFLILSFVLRSTR 458
Fly 459 RSSLILIALL 468 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NtR | NP_651958.2 | Methyltransf_FA | 90..191 | CDD:289052 | |
Neur_chan_LBD | 212..429 | CDD:280998 | 50/225 (22%) | ||
Htr3b | NP_071525.1 | LIC | 30..431 | CDD:273305 | 63/270 (23%) |
Neur_chan_LBD | 30..233 | CDD:280998 | 42/169 (25%) | ||
Neur_chan_memb | 242..>313 | CDD:280999 | 16/73 (22%) | ||
HA-stretch | 377..409 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3645 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |