DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and Htr3b

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_064670.1 Gene:Htr3b / 57014 MGIID:1861899 Length:437 Species:Mus musculus


Alignment Length:408 Identity:77/408 - (18%)
Similarity:132/408 - (32%) Gaps:110/408 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 LLSHLNIQAENASMPANLSSISFHFQTRSLAY-------------EQTSSLLQTRMHMMMH---- 266
            |::.:.|.......|.|   .|.|..||.|..             |.|:..|...:|.::.    
Mouse     9 LVAVVGILGTATPQPGN---SSLHRLTRQLLQQYHKEVRPVYNWAEATTVYLDLCVHAVLDVDVQ 70

  Fly   267 -------------WRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYEL-M 317
                         |.|..|.|....|..::....|...:|.|.: ::|    ....|.:|.:| .
Mouse    71 NQKLKTSVWYREVWNDEFLSWNSSLFDEIQEISLPLSALWAPDI-IIN----EFVDVERSPDLPY 130

  Fly   318 VYANGSITLYAQN-LQLASWCVDSARNWPSERVTC------------DIELG-LNGQEGQEN--V 366
            ||.|.|.|:.... :|:.|.|......:|.:...|            ||:|| |..:|..||  .
Mouse   131 VYVNSSGTIRNHKPIQVVSACSLQTYAFPFDIQNCSLTFNSILHTVEDIDLGFLRNREDIENDKR 195

  Fly   367 ALIYDD--QRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRN 429
            |.:.|.  |...::...|:...|...|.|:           |:|               ..::|.
Mouse   196 AFMNDSEWQLLSVSSTYHIRQSSAGDFAQI-----------RFN---------------VVIRRC 234

  Fly   430 RSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVP------P 488
            ...|:....:|.|...:..:.||.|....|:.::....::..:.:.   |......||      |
Mouse   235 PLAYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTNVLVGYTVF---RVNMSDEVPRSAGCTP 296

  Fly   489 MMTAYKVIMMTTTYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTD----- 548
            ::..:..:.|......:....::...||..|...        ....|.|:.|  .||:.:     
Mouse   297 LIGVFFTVCMALLVLSLSKSILLIKFLYEERHSG--------QERPLMCLQG--DSDAEESRLYL 351

  Fly   549 ---YCDIQENPWHHMAKI 563
               ..|:.|:|.|...::
Mouse   352 GAPRADVTESPVHQEHRV 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 52/258 (20%)
Htr3bNP_064670.1 LIC 30..431 CDD:273305 71/384 (18%)
Neur_chan_LBD 30..233 CDD:280998 46/233 (20%)
Neur_chan_memb 242..>313 CDD:280999 11/73 (15%)
HA-stretch 377..409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.