DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and chrne

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001314812.1 Gene:chrne / 445315 ZFINID:ZDB-GENE-040808-32 Length:517 Species:Danio rerio


Alignment Length:378 Identity:78/378 - (20%)
Similarity:144/378 - (38%) Gaps:61/378 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 FDGYGSEIAPI--VKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRM 261
            |..|...|.|.  ..|:.|.:..|:..|:.:.|..                   |:|   |.|.:
Zfish    37 FKNYSKNIRPARHADEKVKVQVKLTLTNLISLNEK-------------------EET---LTTNV 79

  Fly   262 HMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSI-- 324
            .:.:.|.|.||.|...::..:|....|...:|.|.: ||...:.....|.....:::.::||:  
Zfish    80 WIEIQWHDYRLAWNTSEYHDIEQIRVPYYTVWLPDI-VLENNIDGKFDVAYYANVLISSDGSMYW 143

  Fly   325 ---TLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQE-NVALIYDDQRKPIAPNEHVN- 384
               .:|      .|.|......:|.:...|.:..........| ::.|..|:..|||   |.|: 
Zfish   144 LPPAIY------RSTCAIEITYFPFDWQNCTLVFRSQTYSANEIDIVLAEDENGKPI---EWVDI 199

  Fly   385 -----TPSG-WSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIA 443
                 |.:| |:........:.|   :||:|..:..:   :|.....:||...||:....||...
Zfish   200 DPEAFTENGEWAIKHRPARKLTN---QRYSPDDLEYQ---EVYYNIIIQRKPLFYVINIILPCSL 258

  Fly   444 CQMFLILSFVL--RSTRRSSLILIALLIAAWGLMYMTRYASPH--YVPPMMTAYKVIMMTTTYCY 504
            ....::|::.|  ::..:...:.|::|:|....:.:.....|.  ...|::..|.:.:|:.|...
Zfish   259 ISSLVVLAYFLPAKAGGQKLTVSISVLLAQTVFLILISQKIPETSLSVPLIGKYLIFVMSMTTLI 323

  Fly   505 ILHICIIWLD--LYPPRSKAPGWLVRVINSNVLRCILGLR-FSDSTDYCDIQE 554
            :.: |||.|:  |..|.:......::.|...|:...||:. |.|..|...:.|
Zfish   324 VTN-CIIVLNYSLRSPSTHNMSQSIKHIFLEVVPRYLGMAPFVDEGDQGGVYE 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 45/229 (20%)
chrneNP_001314812.1 LIC 10..495 CDD:273305 78/378 (21%)
Neur_chan_LBD 29..245 CDD:280998 50/245 (20%)
Neur_chan_memb 252..494 CDD:280999 26/125 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.