DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and pHCl-2

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001303470.1 Gene:pHCl-2 / 43703 FlyBaseID:FBgn0039840 Length:526 Species:Drosophila melanogaster


Alignment Length:452 Identity:83/452 - (18%)
Similarity:150/452 - (33%) Gaps:146/452 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 SVTNHPRPNDRVYEIVIGAGGNTFS---AIRNAMGMRRVATNQEPNLVSLYDPTPIEIVQNQNGE 154
            ||...|......:.:.|....:|.:   :::||..|..:...........||.....:|.|::||
  Fly    35 SVVVSPLNTTDAFSVSINLSQSTVNNCPSLKNAESMALMELLTRLTAPCRYDRMVPPVVHNKDGE 99

  Fly   155 ---------LFVYIPGFKKEPLLQFIDEAPLVINY----LSFSSFGSNTARWFYDCGFDGYGSEI 206
                     .::|:........|||..:..|.:.|    |:|||:..|..:              
  Fly   100 EVPMDIYARFYIYVMKNLDSSDLQFTVQGLLQLRYLDPRLAFSSYLPNRRQ-------------- 150

  Fly   207 APIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSR 271
             ||: .|::.:|:|                                                   
  Fly   151 -PIM-GESELKKML--------------------------------------------------- 162

  Fly   272 LVWKPEDFGSLESFEHPDLRIWKPHMNVLN-GALQSMGQVLQSYELMVYANGSITLYAQNLQLAS 335
                                 |.||:.:.| .|...:|...:.....:|.||:: |.:..||...
  Fly   163 ---------------------WVPHIFLTNEQASTVLGTSAKDELTSIYPNGTV-LTSTRLQATL 205

  Fly   336 WCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSF------TQM 394
            :|..:.:.:|.:...|...|    :....|..|:          ..|..|.:..||      |:.
  Fly   206 YCWMNFQKFPFDEQKCKTTL----ESWMYNTTLV----------QLHWETDNPVSFDKQLQLTEY 256

  Fly   395 SVV-LVENDSQRRYNPKGMMQ-KMTGDVA-IEFT--LQRNRSFYMTVFYLPLIACQMFLILSFVL 454
            ::: .:.|:|.|..|...|.. .:.|:.: |.||  |.|...:|:..::||.|.......:||.|
  Fly   257 NLIGSLYNESIRVSNESYMSHGSLEGNYSIISFTVLLTREVGYYVIDYFLPSIMIVTISWVSFWL 321

  Fly   455 RSTR---RSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICIIWL 513
            ::.:   |::|....|      |.::|...|..     ....||..:|.:..:.| :|.|::
  Fly   322 QADQTPARTTLGCTTL------LSFITLSLSQE-----NNLMKVSYVTMSEVWFL-VCTIFI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 25/113 (22%)
Neur_chan_LBD 212..429 CDD:280998 36/228 (16%)
pHCl-2NP_001303470.1 LIC 46..522 CDD:273305 80/441 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.