DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and GluClalpha

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001287408.1 Gene:GluClalpha / 42350 FlyBaseID:FBgn0024963 Length:463 Species:Drosophila melanogaster


Alignment Length:205 Identity:42/205 - (20%)
Similarity:82/205 - (40%) Gaps:51/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 WRDSRLVWKPEDF-GSLESFEHPDL-RIWKPHM---NVLNGALQSMGQVLQSYELMVYANGSITL 326
            |.|.||  |.:|. |.|:.....:. |:|.|.:   |...|...::  ::.:..:.::.|||: |
  Fly    93 WTDERL--KFDDIQGRLKYLTLTEANRVWMPDLFFSNEKEGHFHNI--IMPNVYIRIFPNGSV-L 152

  Fly   327 YAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSF 391
            |:..:.|...|..:.:.:|.:|..|.:.:...|....:.|.|..:.....:..|.|:        
  Fly   153 YSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHL-------- 209

  Fly   392 TQMSVVLVENDSQRRYNPKGMMQKM----------TGD---VAIEFTLQRNRSFYMTVFYLPLIA 443
                             |:..::|.          ||:   :.::...:|..|:|:...|:|   
  Fly   210 -----------------PRFTLEKFLTDYCNSKTNTGEYSCLKVDLLFKREFSYYLIQIYIP--- 254

  Fly   444 CQMFLILSFV 453
            |.|.:|:|:|
  Fly   255 CCMLVIVSWV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 32/179 (18%)
GluClalphaNP_001287408.1 LIC 3..455 CDD:273305 42/205 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.