DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and pHCl-1

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster


Alignment Length:399 Identity:83/399 - (20%)
Similarity:159/399 - (39%) Gaps:71/399 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 IDEAPLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEK-LLSHLN-------IQA 227
            :|:.|  |:.:.:|.|..:::           ..||..::.|:.:.:| ||..:|       :|:
  Fly   318 LDKHP--IHGIDWSKFDESSS-----------DKEILDLLLEKKRYDKRLLPPVNDEDFCCGLQS 369

  Fly   228 ------ENASMPANLSSISFHFQT--RSLAYEQTSSL-LQTRMHMMMHWRDSRLVW-KPEDFGSL 282
                  :||..|.|..:::.:...  .|||....||| .:....:...|.|.||.: ....:..|
  Fly   370 PDMATNQNARRPHNRGTLTVNVNVLLLSLASPDESSLKYEVEFLLNQQWNDPRLQYGNKSHYDFL 434

  Fly   283 ESFEHPDLRIWKPHMN-VLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPS 346
            .:..|.| .||.|... :::|..:. ..:...:.|.::.||:|| ||....|...|..|...:|.
  Fly   435 NALHHHD-SIWTPDTYFIMHGDFKD-PIIPMHFALRIFRNGTIT-YAMRRHLILSCQGSLHIFPF 496

  Fly   347 ERVTCDIELGLNGQEGQENVALIYDD-QRKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPK 410
            :...|...:        |:::  |:: |.|.:..|:........|.|.::..|::|  |.....:
  Fly   497 DDPKCSFSM--------ESIS--YEEAQIKYVWKNDEDTLRKSPSLTTLNAYLIKN--QTTACDQ 549

  Fly   411 GMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLM 475
            ...:.....:.:|.|..|:|::|.|..::|.|.......::|.|......:.::|.:...   |.
  Fly   550 NSWRGNYSCLQVELTFTRDRAYYFTTVFIPGIILVTSSFITFWLEWNAVPARVMIGVTTM---LN 611

  Fly   476 YMTR---YASPHYVPPMMTAYKV---IMMTTTYCYILH-ICIIWLD--------LY-----PPRS 520
            :.|.   :.|...|...:||..|   :.|...|..:|. :|:.::.        :|     |...
  Fly   612 FFTTSNGFRSTLPVVSNLTAMNVWDGVCMCFIYASLLEFVCVNYVGRKRPLHNVVYRPGENPVTQ 676

  Fly   521 KAPGWLVRV 529
            :.|..|.|:
  Fly   677 RLPAVLSRI 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 5/19 (26%)
Neur_chan_LBD 212..429 CDD:280998 51/236 (22%)
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 53/242 (22%)
Neur_chan_memb 578..>682 CDD:280999 19/106 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.