DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and HTR3A

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_998786.3 Gene:HTR3A / 3359 HGNCID:5297 Length:510 Species:Homo sapiens


Alignment Length:359 Identity:64/359 - (17%)
Similarity:126/359 - (35%) Gaps:102/359 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 LAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQ 312
            |..::.:.:|.|.:....:|.|..|.|.||||.::.....|...||.|  ::|......:|:...
Human    71 LNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVP--DILINEFVDVGKSPN 133

  Fly   313 SYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPI 377
            ...:.:...|.:..| :.||:.:.|.....|:|.:...|.:                        
Human   134 IPYVYIRHQGEVQNY-KPLQVVTACSLDIYNFPFDVQNCSL------------------------ 173

  Fly   378 APNEHVNTPSGWSFTQMSVVL--------VEND-----SQRRYNPKGMMQKMTGDVAIEFTLQRN 429
                   |.:.|..|...:.:        |::|     :|..:...|::....     ||:::.:
Human   174 -------TFTSWLHTIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFR-----EFSMESS 226

  Fly   430 RSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYK 494
            ..:....||:.:....:|.::|.:|     .|:.|:.:.|..:            |:||......
Human   227 NYYAEMKFYVVIRRRPLFYVVSLLL-----PSIFLMVMDIVGF------------YLPPNSGERV 274

  Fly   495 VIMMTTTYCYILHICII------------WLDLYPPRSK-------APGWLVRVINSNVLRCILG 540
            ...:|....|.:.:.|:            .:...||.|:       ||..|:.|..::.|.| .|
Human   275 SFKITLLLGYSVFLIIVSDTLPATAIGTPLIGKAPPGSRAQSGEKPAPSHLLHVSLASALGC-TG 338

  Fly   541 LRFSDSTDYCDIQENPWHHMAKILNNLSSILVII 574
            :.|.    .|         ||.::.:|:..:.|:
Human   339 VYFV----VC---------MALLVISLAETIFIV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 34/193 (18%)
HTR3ANP_998786.3 LIC 23..504 CDD:273305 64/359 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.