DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and Lcch3

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_996469.1 Gene:Lcch3 / 32554 FlyBaseID:FBgn0010240 Length:496 Species:Drosophila melanogaster


Alignment Length:377 Identity:69/377 - (18%)
Similarity:130/377 - (34%) Gaps:91/377 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 GYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMM 265
            ||...:.|               |...|...:..:|:..||.      |..:.:......|::..
  Fly    50 GYDIRLRP---------------NFGGEPLHVGMDLTIASFD------AISEVNMDYTITMYLNQ 93

  Fly   266 HWRDSRLVWKPEDFGSLESFEHPD-------------LRIWKPHMNVLNGALQSMGQVLQSYELM 317
            :|||.||.:  ..||.....|:.|             .:||.|.....|.....:..|.:..:|:
  Fly    94 YWRDERLAF--NIFGQYFDDENDDGISDVLTLSGDFAEKIWVPDTFFANDKNSFLHDVTERNKLV 156

  Fly   318 -VYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNE 381
             :..:|::| |.........|:.....:|.:...|.:|:...|.. ..:|.:.:  :..|:...|
  Fly   157 RLGGDGAVT-YGMRFTTTLACMMDLHYYPLDSQNCTVEIESYGYT-VSDVVMYW--KPTPVRGVE 217

  Fly   382 HVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQM 446
            ....|      |.:::..|.:.::.....|:.|::    ::.|.||||..:::...|||.|...|
  Fly   218 DAELP------QFTIIGYETNDRKERLATGVYQRL----SLSFKLQRNIGYFVFQTYLPSILIVM 272

  Fly   447 FLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICII 511
            ...:||.:.....|:.:.:.:.                         .|:.|||....:      
  Fly   273 LSWVSFWINHEATSARVALGIT-------------------------TVLTMTTISTGV------ 306

  Fly   512 WLDLYPPRSKAPG-WLVRVINSNVLRCILGLRFSDSTDYCDIQENPWHHMAK 562
                   ||..|. ..|:.|:..::.|.:.: |:...:|..:....|...||
  Fly   307 -------RSSLPRISYVKAIDIYLVMCFVFV-FAALLEYAAVNYTYWGKRAK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 41/230 (18%)
Lcch3NP_996469.1 LIC 15..493 CDD:273305 69/377 (18%)
Neur_chan_LBD 47..256 CDD:280998 45/242 (19%)
Neur_chan_memb 263..490 CDD:280999 23/127 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.