DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and GLRA2

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001112357.1 Gene:GLRA2 / 2742 HGNCID:4327 Length:452 Species:Homo sapiens


Alignment Length:312 Identity:67/312 - (21%)
Similarity:115/312 - (36%) Gaps:81/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 GYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMM 265
            ||.:.|.|               |.:....::..|:...||...|      :|:...:..:.:..
Human    57 GYDARIRP---------------NFKGPPVNVTCNIFINSFGSVT------ETTMDYRVNIFLRQ 100

  Fly   266 HWRDSRLVWK--PEDFGSLESFEHPDL--RIWKPHMNVLNGALQSMGQVLQSYELM-VYANGSIT 325
            .|.||||.:.  |:|...|:    |.:  .||||.:...|....:...|....:|: :..||.: 
Human   101 QWNDSRLAYSEYPDDSLDLD----PSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKV- 160

  Fly   326 LYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWS 390
            ||:..|.|...|....:|:|.:..||.::|...|....:.:.....|  .|:...|.:..|    
Human   161 LYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSD--GPVQVAEGLTLP---- 219

  Fly   391 FTQMSVVLVENDS----QRRYNPKGMMQKMTGD---VAIEFTLQRNRSFYMTVFYLPLIACQMFL 448
                ..:|.|...    .:.||        ||.   :.::|.|:|...:|:...|:|        
Human   220 ----QFILKEEKELGYCTKHYN--------TGKFTCIEVKFHLERQMGYYLIQMYIP-------- 264

  Fly   449 ILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTT 500
                        ||:::   |.:|...::...|:|..|...:|.  |:.|||
Human   265 ------------SLLIV---ILSWVSFWINMDAAPARVALGITT--VLTMTT 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 47/228 (21%)
GLRA2NP_001112357.1 LIC 46..441 CDD:273305 67/312 (21%)
Strychnine-binding. /evidence=ECO:0000250|UniProtKB:O93430 236..241 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.