DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and Chrna5

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_058774.2 Gene:Chrna5 / 25102 RGDID:2347 Length:467 Species:Rattus norvegicus


Alignment Length:406 Identity:70/406 - (17%)
Similarity:141/406 - (34%) Gaps:128/406 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 EQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVL---NGALQSMGQVLQ 312
            ::.:.|:.|.:.:...|.|.:|.|.|:|:|.::....|...:|.|.:.:.   :|..:.     .
  Rat    87 DEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVLFDNADGRFEG-----A 146

  Fly   313 SYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPI 377
            |.:.:|..||::| :.|.....|.|......:|.:...|.::.|                     
  Rat   147 STKTVVRYNGTVT-WTQPANYKSSCTIDVTFFPFDLQNCSMKFG--------------------- 189

  Fly   378 APNEHVNTPSGWSF--TQMSVVLVENDSQRR-YNPKGMMQKMT-----GD----------VAIEF 424
                      .|::  :|:.::|.:.|..|. :...|..:.|:     |:          :...|
  Rat   190 ----------SWTYDGSQVDIILEDQDVDRTDFFDNGEWEIMSAMGSKGNRTDSCCWYPYITYSF 244

  Fly   425 TLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSL-----ILIALLIAAWGLMYMTRYASPH 484
            .::|...||.....:|.|......::.|.|.|.....:     :|::|.:  :.|:......|..
  Rat   245 VIKRLPLFYTLFLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTV--FLLVIEEIIPSSS 307

  Fly   485 YVPPMMTAYKVI--------MMTTTYCYILH-------------ICIIWLDLYPP----RSKAPG 524
            .|.|::..|.|.        :|.|.:...:|             :..|:|...|.    ||.|..
  Rat   308 KVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVRKIFLHKLPKLLCMRSHADR 372

  Fly   525 WL------------------------VRVINSNVLRCILGLRFSDSTDYCDIQENPWHHMAKILN 565
            :.                        :|.|..:|::         ..|..::.|: |..:|::|:
  Rat   373 YFTQREEAESGAGPKSRNTLEAALDCIRYITRHVVK---------ENDVREVVED-WKFIAQVLD 427

  Fly   566 NLSSILVIITFAIVDI 581
            .    :.:.||.:|.|
  Rat   428 R----MFLWTFLLVSI 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 33/198 (17%)
Chrna5NP_058774.2 LIC 41..448 CDD:273305 70/406 (17%)
Neur_chan_LBD 47..250 CDD:280998 34/199 (17%)
Neur_chan_memb 257..446 CDD:280999 34/199 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.