DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and Chrnb1

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001382047.1 Gene:Chrnb1 / 24261 RGDID:2349 Length:504 Species:Rattus norvegicus


Alignment Length:368 Identity:82/368 - (22%)
Similarity:142/368 - (38%) Gaps:45/368 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GSEIAPIVKEETKTEKLLSHLNIQAENASMPA----NLSSISFHF---QTRSLAYE-QTSSLLQT 259
            |:.:||..:......:||..|....:::..||    :...:|...   |..||..| :....:.|
  Rat    14 GTPLAPGARGSEAEGQLLKKLFSDYDSSVRPAQEVGDRVGVSIGLTLAQLISLVRENEKDEEMST 78

  Fly   260 RMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSI 324
            ::::.:.|.|.||.|.|.:...:||.......:|.|.:.:||.. .....|.....::|...||:
  Rat    79 KVYLDLEWTDYRLSWDPAEHDGIESLRVTAESVWLPDVVLLNNN-DGNFDVALDINVVVSFEGSV 142

  Fly   325 T-----LYAQNLQLA------SW--C--VDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQR 374
            .     ||..:..:.      .|  |  |.|:.::.|..|:.......:|||.||    ||..:.
  Rat   143 RWQPPGLYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLKTGPDPDGQERQE----IYIHEG 203

  Fly   375 KPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYL 439
            ..|...:       |........|:.....||...:|..:    :|.....::|...||:.....
  Rat   204 TFIENGQ-------WEIIHKPSRLIHLPGDRRGGKEGHRE----EVIFYLIIRRKPLFYLVNVIA 257

  Fly   440 PLIACQMFLILSFVL--RSTRRSSLILIALL-IAAWGLMYMTRYASPHYVPPMMTAYKVI-MMTT 500
            |.|...:..|..|.|  .:..:..|.:.||| :..:.|:...:........|::..|.:. |:..
  Rat   258 PCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPETSLAVPIIIKYLMFTMILV 322

  Fly   501 TYCYILHICIIWLDLYPPRS-KAPGWLVRVINSNVLRCILGLR 542
            |:..||.:.::.|....|.: :.|.| ||.|..:.|...|||:
  Rat   323 TFSVILSVVVLNLHHRSPHTHQMPFW-VRQIFIHKLPPYLGLK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 49/239 (21%)
Chrnb1NP_001382047.1 LGIC_ECD_nAChR_B1 27..248 CDD:349825 50/236 (21%)
Neur_chan_memb 255..490 CDD:397193 27/111 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..384 82/368 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.