DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and acr-23

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_504024.2 Gene:acr-23 / 191606 WormBaseID:WBGene00000062 Length:545 Species:Caenorhabditis elegans


Alignment Length:354 Identity:62/354 - (17%)
Similarity:118/354 - (33%) Gaps:112/354 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 TRSLAYEQTSSLLQTRMHMMMH------WRDSRLVWKPEDFGSLESF--EHPDLRIWKPHMNVLN 301
            |.||...|...:.:.:.:::::      |.|..|.|.|.:|.:....  .|.|  ||.|...:.|
 Worm    55 TLSLQLYQIIQVNEPQQYLLLNAWAVERWVDQMLGWDPSEFDNETEIMARHDD--IWLPDTTLYN 117

  Fly   302 G--------------ALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCD 352
            .              .|.::|:...:...::|.    |:|..:      |:.:.:.:|.:..||.
 Worm   118 SLEMDDSASKKLTHVKLTTLGKNQGAMVELLYP----TIYKIS------CLLNLKYFPFDTQTCR 172

  Fly   353 IELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSG---------WSFTQMSVVLVENDSQRRYN 408
            :..|          :..:|:......|....|.|.|         ||.....|    |..:::|.
 Worm   173 MTFG----------SWSFDNSLIDYFPRTFTNGPIGLANFLENDAWSVLGTKV----NREEKKYT 223

  Fly   409 --PKGMMQKMTGDVAIEFTL-------QRNRSFYMTVFYLPLIACQMFLILSFV----------- 453
              |            :.:||       ||...:|:.....|........|:.|.           
 Worm   224 CCP------------VNYTLLHYDVVIQRKPLYYVLNLIAPTAVITFISIIGFFTSVNPFTNFCN 276

  Fly   454 ----LRSTRRSSLIL-IALLIAAWGLMYMT--RYASPHYVPPMMTAYKVIMMTTTYCYILHI--- 508
                :...|:..:.| |..|::...:::|.  :..|.....|::..:..:|:|     |:.:   
 Worm   277 VSSSVHDLRQEKITLGITTLLSMSIMIFMVSDKMPSTSTCVPLIALFYTLMIT-----IISVGTL 336

  Fly   509 ---CIIWLDLY-----PPRSKAPGWLVRV 529
               .:|::...     ||.||...|..|:
 Worm   337 AASSVIFVQKLGSIGNPPASKTMKWTHRI 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 40/223 (18%)
acr-23NP_504024.2 Neur_chan_LBD 27..242 CDD:280998 41/224 (18%)
Neur_chan_memb 249..529 CDD:280999 20/122 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5703
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.