DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and HTR3C

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_570126.2 Gene:HTR3C / 170572 HGNCID:24003 Length:447 Species:Homo sapiens


Alignment Length:362 Identity:69/362 - (19%)
Similarity:129/362 - (35%) Gaps:63/362 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 GFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMH 262
            |||.:|  :.|.|.:.....|......    |.|:|..: :|||.. :..|..:....||.:.:.
Human    34 GFDQHG--VDPAVFQAVFDRKAFRPFT----NYSIPTRV-NISFTL-SAILGVDAQLQLLTSFLW 90

  Fly   263 MMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLY 327
            |.:.|.:..:.|.|::...:.........:|.|.:.::..  ..:.|........:.:.|.|. |
Human    91 MDLVWDNPFINWNPKECVGINKLTVLAENLWLPDIFIVES--MDVDQTPSGLTAYISSEGRIK-Y 152

  Fly   328 AQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFT 392
            .:.:::.|.|......:|.::..|.....          :.:|......:..::.|     |..|
Human   153 DKPMRVTSICNLDIFYFPFDQQNCTFTFS----------SFLYTVDSMLLGMDKEV-----WEIT 202

  Fly   393 QMSVVLVENDSQ------RRYNPK-GMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLI- 449
            ..|..:::...:      .:..|| .|...:...:.....::|..|.|:    :.|:....||: 
Human   203 DTSRKVIQTQGEWELLGINKATPKMSMGNNLYDQIMFYVAIRRRPSLYI----INLLVPSSFLVA 263

  Fly   450 ---LSFVL--RSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMM---------TT 500
               |||.|  .|..|:. ..|.||:.....:.|.....|....|:::.|..:.:         |.
Human   264 IDALSFYLPAESENRAP-FKITLLLGYNVFLLMMNDLLPASGTPLISVYFALCLSLMVVSLLETV 327

  Fly   501 TYCYILHICIIWLDLYPPRSKAPGWLVRVINSNVLRC 537
            ...|:||:.    ...||  ..|.||    :|.:|.|
Human   328 FITYLLHVA----TTQPP--PMPRWL----HSLLLHC 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 32/223 (14%)
HTR3CNP_570126.2 Neur_chan_LBD 43..445 CDD:332142 64/351 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..405
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.