DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and Htr3a

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_038589.2 Gene:Htr3a / 15561 MGIID:96282 Length:489 Species:Mus musculus


Alignment Length:309 Identity:66/309 - (21%)
Similarity:116/309 - (37%) Gaps:40/309 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 LAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQ 312
            |..::.:.:|.|.:....:|.|..|.|.||||.::.....|...||.|  ::|......:|:...
Mouse    76 LNVDEKNQVLTTYIWYRQYWTDEFLQWTPEDFDNVTKLSIPTDSIWVP--DILINEFVDVGKSPN 138

  Fly   313 SYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQE-NVALIYDDQRKP 376
            ...:.|:..|.:..| :.|||.:.|.....|:|.:...|.:.........|: |:.|    .|.|
Mouse   139 IPYVYVHHRGEVQNY-KPLQLVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINITL----WRSP 198

  Fly   377 IAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFT-------LQRNRSFYM 434
                |.|.:.......|....|:|...|        .::.:.|::..:.       ::|...||.
Mouse   199 ----EEVRSDKSIFINQGEWELLEVFPQ--------FKEFSIDISNSYAEMKFYVIIRRRPLFYA 251

  Fly   435 TVFYLPLIACQMFLILSFVL---RSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVI 496
            ....||.|...:..|:.|.|   ...|.|..|.:.|..:.:.::......:.....|::..|.|:
Mouse   252 VSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTLPATAIGTPLIGVYFVV 316

  Fly   497 MMTTTYCYILH-ICIIWL----DLYPPRSKAPGWLVRVINSNV--LRCI 538
            .|......:.. |.|:.|    ||..|   .|.||..::...:  :.|:
Mouse   317 CMALLVISLAETIFIVRLVHKQDLQRP---VPDWLRHLVLDRIAWILCL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 39/188 (21%)
Htr3aNP_038589.2 LIC 5..483 CDD:273305 66/309 (21%)
HA-stretch 425..461
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.