DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and AgaP_AGAP006197

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_316262.3 Gene:AgaP_AGAP006197 / 1276862 VectorBaseID:AGAP006197 Length:192 Species:Anopheles gambiae


Alignment Length:189 Identity:55/189 - (29%)
Similarity:85/189 - (44%) Gaps:30/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IDPAESGQLSTRFNVSFAQLDSCETYSVPNTGYGYRR--FYMLRELSNNNRKAGERLHLKFYVLT 84
            |:..|.|.       .|..:..|:.|   ||..||..  :|:.....||....||..:.|..||.
Mosquito    19 IEAEEHGN-------DFDAIKGCKQY---NTEMGYDEPLYYIPTNTLNNTVDHGEFKYYKIGVLG 73

  Fly    85 AMDAHILLSVTNHPRPNDR-VYEIVIGAGGNTFSAIRNAMGMRRVATNQ----------EPNLVS 138
            ..|..|.||  |:..|.|: |.|||:|:..||.|..|.   ..|.::|:          .||:::
Mosquito    74 TNDGVIRLS--NYMYPYDKNVTEIVVGSHWNTRSGGRT---QYRTSSNEYKNTDMVRALTPNMLN 133

  Fly   139 LYDPTPIEIVQNQNGELFVYIPGFKKEPLLQFIDEAPLVINYLSFSSFGSNTARWFYDC 197
            .:.|..:::....:|:..|:..| ...|.|.|:|...|.:||::|:. .:.|..:||||
Mosquito   134 PFRPVMLKLKLWVDGKKEVFHDG-HDYPFLGFMDTQKLPVNYMAFTR-RNLTLVFFYDC 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 31/111 (28%)
Neur_chan_LBD 212..429 CDD:280998
AgaP_AGAP006197XP_316262.3 Methyltransf_FA 79..185 CDD:289052 32/112 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.