DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and AgaP_AGAP010580

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_314547.2 Gene:AgaP_AGAP010580 / 1275309 VectorBaseID:AGAP010580 Length:186 Species:Anopheles gambiae


Alignment Length:179 Identity:66/179 - (36%)
Similarity:96/179 - (53%) Gaps:8/179 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLLILIDPAESGQLSTRFNVSFAQLDSCETYSVPNTGYGYRRFYMLRELSNNN-RKAGERLHLKF 80
            |||:|:  .|....:||:||||.:|..|:.::..| ||.||.|:.|.||.::| ..|...:.|..
Mosquito    13 LLLVLV--IECHADTTRYNVSFDELHRCKQHNAIN-GYNYRAFFKLHELDHHNPANADLIVDLLV 74

  Fly    81 YVLTAMDAHILLSVTNHPRPNDRVYEIVIGAGGNTFSAIRNAMGMRRVATNQEPNLVSLYDPTPI 145
            |||.|.|.|||||..|...|.  ..|||:|.||||||.||.......:.|.....|:|..||.|:
Mosquito    75 YVLAARDGHILLSEQNKTAPT--ALEIVLGGGGNTFSQIRFGQKGSPLRTKASAGLLSPIDPLPV 137

  Fly   146 EIVQNQNGELFVYIPGFKKEPLLQFI--DEAPLVINYLSFSSFGSNTAR 192
            .:..|..|::.||......||.::.:  .:....:.|:||:::|:..|:
Mosquito   138 RVRINTEGQVRVYAGNLTGEPFMETMMPKKNASELRYISFTTWGTALAK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 34/102 (33%)
Neur_chan_LBD 212..429 CDD:280998
AgaP_AGAP010580XP_314547.2 Methyltransf_FA 84..185 CDD:289052 34/102 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I17998
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I6621
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016625
OrthoInspector 1 1.000 - - otm49784
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.