DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and CHRNB4

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_000741.1 Gene:CHRNB4 / 1143 HGNCID:1964 Length:498 Species:Homo sapiens


Alignment Length:349 Identity:80/349 - (22%)
Similarity:136/349 - (38%) Gaps:64/349 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EKLLSHL--NIQAENASMPANLSS--ISFHFQ---TRSLAYEQTSSLLQTRMHMMMHWRDSRLVW 274
            |||:..|  ..:..|...||..||  ||...|   .:.::..:...::.|.:.:...|.|.||.|
Human    28 EKLMDDLLNKTRYNNLIRPATSSSQLISIKLQLSLAQLISVNEREQIMTTNVWLKQEWTDYRLTW 92

  Fly   275 KPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVY------ANGSITLYAQNLQL 333
            ....:..:.....|..|||.|.:.:.|.|       ..:||:.||      :|||: |:......
Human    93 NSSRYEGVNILRIPAKRIWLPDIVLYNNA-------DGTYEVSVYTNLIVRSNGSV-LWLPPAIY 149

  Fly   334 ASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQR------KPIAPNEHVNTPSG-WSF 391
            .|.|....:.:|.::..|.::..          :..||...      .|.|..:.. |||| |. 
Human   150 KSACKIEVKYFPFDQQNCTLKFR----------SWTYDHTEIDMVLMTPTASMDDF-TPSGEWD- 202

  Fly   392 TQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRS 456
                  :|....:|..||:   .....||..:|.::|...||.....:|.:...:..||.|.|.|
Human   203 ------IVALPGRRTVNPQ---DPSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILVFYLPS 258

  Fly   457 T--RRSSLILIALLIAAWGLMYMTRYASPHYVP-PMMTAYKVI-MMTTTYCYILHICIIWLDLYP 517
            .  .:.:|.:..||...:.|:.:::...|..:. |::..|.:. |:..|:..:..:|::.:....
Human   259 DCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRS 323

  Fly   518 P--RSKAPGWLVRVINSNVLRCIL 539
            |  .:.|| |        |.||.|
Human   324 PSTHTMAP-W--------VKRCFL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 53/231 (23%)
CHRNB4NP_000741.1 Neur_chan_LBD 5..480 CDD:332142 80/349 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.