DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and CHRNA5

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_000736.2 Gene:CHRNA5 / 1138 HGNCID:1959 Length:468 Species:Homo sapiens


Alignment Length:471 Identity:89/471 - (18%)
Similarity:159/471 - (33%) Gaps:140/471 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 CGFDGYG-------SEIAPIVKEETKTEKLL-----------SHLNIQAENASMPANLSSISFHF 243
            ||..|..       ||.:.|.|.|....|.|           .|||.:.:          |.|..
Human    24 CGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIK----------IKFGL 78

  Fly   244 QTRSLA-YEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVL---NGAL 304
            ....|. .::.:.|:.|.:.:...|.|.:|.|.|:|:|.::....|...:|.|.:.:.   :|..
Human    79 AISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRF 143

  Fly   305 QSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALI 369
            :.     .|.:.::..||::| :.......|.|......:|.:...|.::.|             
Human   144 EG-----TSTKTVIRYNGTVT-WTPPANYKSSCTIDVTFFPFDLQNCSMKFG------------- 189

  Fly   370 YDDQRKPIAPNEHVNTPSGWSF--TQMSVVLVENDSQRR---YNPKGMMQKMTGD---------- 419
                              .|::  :|:.::|.:.|..:|   .|.:..:...||.          
Human   190 ------------------SWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCW 236

  Fly   420 ---VAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRSSLIL---IALLIAAWGLMYMT 478
               |...|.::|...||.....:|.|......:|.|.|.|.....:.|   :.:.:..:.|:...
Human   237 YPYVTYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIEE 301

  Fly   479 RYASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLYPPRSK-----APGWLVRVINSNVLRCI 538
            ...|...|.|::..|.|..|......|: :.:..::::...|.     ||  |||.|..:.|..:
Human   302 IIPSSSKVIPLIGEYLVFTMIFVTLSIM-VTVFAINIHHRSSSTHNAMAP--LVRKIFLHTLPKL 363

  Fly   539 LGLR------FS----------------------DSTDYC--------DIQE--NPWHHMAKILN 565
            |.:|      |:                      ||..|.        |::|  ..|..:|::|:
Human   364 LCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDWKFIAQVLD 428

  Fly   566 NLSSILVIITFAIVDI 581
            .    :.:.||..|.|
Human   429 R----MFLWTFLFVSI 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 41/249 (16%)
CHRNA5NP_000736.2 LIC 39..449 CDD:273305 85/456 (19%)
Neur_chan_LBD 47..250 CDD:280998 42/249 (17%)
Neur_chan_memb 257..447 CDD:280999 38/191 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.