DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and CHRNA3

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_000734.2 Gene:CHRNA3 / 1136 HGNCID:1957 Length:505 Species:Homo sapiens


Alignment Length:345 Identity:69/345 - (20%)
Similarity:138/345 - (40%) Gaps:34/345 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 IAPIVKEETKTEKLLSHLNIQAENASMP-ANLSS-ISFHFQ---TRSLAYEQTSSLLQTRMHMMM 265
            :.|:.:......:|...|.........| ||:|. :..||:   ::.:..::.:.:::|.:.:..
Human    25 LLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQ 89

  Fly   266 HWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQN 330
            .|.|.:|.|.|.|:|..|....|..:||||.:.:.|.|:... ||....:.::...|.:|.....
Human    90 IWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDF-QVDDKTKALLKYTGEVTWIPPA 153

  Fly   331 LQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQR-KPIAPNEHVNTPSGWSFTQM 394
            : ..|.|......:|.:...|.::.|          :..||..: ..:.....:|....|...:.
Human   154 I-FKSSCKIDVTYFPFDYQNCTMKFG----------SWSYDKAKIDLVLIGSSMNLKDYWESGEW 207

  Fly   395 SVVLV---ENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRS 456
            :::..   ::|.  :||   ..:::..|:.....::|...||.....:|.:......:|.|.|.|
Human   208 AIIKAPGYKHDI--KYN---CCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPS 267

  Fly   457 T--RRSSLILIALLIAAWGLMYMTR-YASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLY-- 516
            .  .:.:|.:..||.....|:.:|. ..|...|.|::..|.:..|......|: |.:..|:::  
Human   268 DCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIV-ITVFVLNVHYR 331

  Fly   517 -PPRSKAPGWLVRVINSNVL 535
             |.....|.| |:.:..|:|
Human   332 TPTTHTMPSW-VKTVFLNLL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 41/225 (18%)
CHRNA3NP_000734.2 Neur_chan_LBD 30..496 CDD:332142 68/340 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.