DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and Chrna2

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_659052.1 Gene:Chrna2 / 110902 MGIID:87886 Length:512 Species:Mus musculus


Alignment Length:327 Identity:67/327 - (20%)
Similarity:129/327 - (39%) Gaps:32/327 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EKLLSHL----NIQAENASMPANLSSISFHFQTRSLA-YEQTSSLLQTRMHMMMHWRDSRLVWKP 276
            ::|..||    |..|......:::..:.|......|. .::.:.::.|.:.:...|.|.:|.|.|
Mouse    37 DRLFKHLFGGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDP 101

  Fly   277 EDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSA 341
            .:||::.|...|...||.|.:.:.|.| .....|....:..::..|::......:..:|..:| .
Mouse   102 AEFGNITSLRVPSEMIWIPDIVLYNNA-DGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSID-V 164

  Fly   342 RNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEH-VNTPSGWSFTQMSVVLVENDSQR 405
            ..:|.::..|.::.|          :..||..:..:...|. |:....|...:.:::    ::..
Mouse   165 TFFPFDQQNCKMKFG----------SWTYDKAKIDLEQMERTVDLKDYWESGEWAII----NATG 215

  Fly   406 RYNPK--GMMQKMTGDVAIEFTLQRNRSFYMTVFYLP--LIACQMFLILSFVLRSTRRSSLILIA 466
            .||.|  ....::..||...|.::|...||.....:|  ||:|...|:.........:.:|.:..
Mouse   216 TYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISV 280

  Fly   467 LLIAAWGLMYMTR-YASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLY---PPRSKAPGWLV 527
            ||.....|:.:|. ..|...|.|::..|.:..|......|: |.:..|:::   |.....|.| |
Mouse   281 LLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIV-ITVFVLNVHHRSPSTHNMPNW-V 343

  Fly   528 RV 529
            ||
Mouse   344 RV 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 40/219 (18%)
Chrna2NP_659052.1 LIC 15..505 CDD:273305 67/327 (20%)
LGIC_ECD_nAChR_A2 36..242 CDD:349816 41/220 (19%)
Cys-loop 160..174 CDD:349816 2/14 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.