DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and Chrnb4

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_683746.1 Gene:Chrnb4 / 108015 MGIID:87892 Length:495 Species:Mus musculus


Alignment Length:326 Identity:72/326 - (22%)
Similarity:128/326 - (39%) Gaps:67/326 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EKLLSHL--NIQAENASMPANLSS--ISFHFQ---TRSLAYEQTSSLLQTRMHMMMHWRDSRLVW 274
            |||:..|  ..:..|...||..||  ||...:   ::.::..:...::.|.:.:...|.|.||.|
Mouse    27 EKLMDDLLNKTRYNNLIRPATSSSQLISIRLELSLSQLISVNEREQIMTTSIWLKQEWTDYRLAW 91

  Fly   275 KPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVY------ANGSI-----TLY- 327
            ....:..:.....|..|:|.|.:.:.|.|       ..:||:.||      :||||     .:| 
Mouse    92 NSSCYEGVNILRIPAKRVWLPDIVLYNNA-------DGTYEVSVYTNVIVRSNGSIQWLPPAIYK 149

  Fly   328 -AQNLQLASW------CVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNT 385
             |..:::..:      |....|:|..:....|:.|        ::...|.||           .|
Mouse   150 SACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVL--------KSPTAIMDD-----------FT 195

  Fly   386 PSG-WSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLI 449
            ||| |.       :|....:|..||:   .....||..:|.::|...||.....:|.:......|
Mouse   196 PSGEWD-------IVALPGRRTVNPQ---DPSYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAI 250

  Fly   450 LSFVLRST--RRSSLILIALLIAAWGLMYMTRYASPHYVP-PMMTAYKVI-MMTTTYCYILHICI 510
            |.|.|.|.  .:.:|.:..||...:.|:.:::...|..:. |::..|.:. |:..|:..:..:|:
Mouse   251 LVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLFTMVLVTFSIVTTVCV 315

  Fly   511 I 511
            :
Mouse   316 L 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 53/238 (22%)
Chrnb4NP_683746.1 LIC 21..483 CDD:273305 72/326 (22%)
Neur_chan_LBD 26..231 CDD:280998 54/239 (23%)
Neur_chan_memb 238..481 CDD:280999 16/79 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.