DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and chrna2

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_004914998.2 Gene:chrna2 / 100495873 XenbaseID:XB-GENE-1013893 Length:510 Species:Xenopus tropicalis


Alignment Length:342 Identity:70/342 - (20%)
Similarity:135/342 - (39%) Gaps:34/342 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 EETKT---EKLLSHLNIQAENASMPANLSS----ISFHFQTRSLA-YEQTSSLLQTRMHMMMHWR 268
            |.|:|   |:|...|.......|.|...:|    :.|......|. .::.:.::.|.:.:...|.
 Frog    25 ERTRTHAEERLFKRLFTGYNRWSRPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWN 89

  Fly   269 DSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQNLQL 333
            |.:|.|.|.|:.::.|...|...||.|.:.:.|.| .....:....:..::.||.:......:..
 Frog    90 DYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNA-DGEFAITHMTKAHLFHNGKVKWVPPAIYK 153

  Fly   334 ASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNE-HVNTPSGWSFTQMSVV 397
            :|..:| ...:|.::.:|.::.|          :..||.....:...| :|:....|...:.::|
 Frog   154 SSCSID-VTFFPFDQQSCKMKFG----------SWTYDKAWLDLESMERNVDLKDYWESGEWAIV 207

  Fly   398 LVENDSQRRYNPK--GMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRST--R 458
                ::..:||.|  ....::..|:...|.::|...||.....:|.:......:|.|.|.|.  .
 Frog   208 ----NAVGKYNSKKYDCCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGE 268

  Fly   459 RSSLILIALLIAAWGLMYMTR-YASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLDLY---PPR 519
            :.:|.:..||.....|:.:|. ..|...|.|::..|.:..|......|: |.:..|:::   |..
 Frog   269 KITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIV-ITVFVLNVHHRSPST 332

  Fly   520 SKAPGWLVRVINSNVLR 536
            .|.|.|:..|...::.|
 Frog   333 HKMPLWVRSVFLDHIPR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 43/227 (19%)
chrna2XP_004914998.2 LIC 9..503 CDD:273305 70/342 (20%)
LGIC_ECD_nAChR_A2 32..238 CDD:349816 41/221 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.