DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gom and CG7630

DIOPT Version :9

Sequence 1:NP_524659.1 Gene:gom / 43934 FlyBaseID:FBgn0029084 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_652413.1 Gene:CG7630 / 50266 FlyBaseID:FBgn0040793 Length:90 Species:Drosophila melanogaster


Alignment Length:67 Identity:26/67 - (38%)
Similarity:41/67 - (61%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KPGYFASGGQHAVLSDCPKPEGDFMKAWSAKNSRYNLILVSGILAAGGTLGFALSSGVLCLNWTI 134
            :..|....|.|:.::|.|.|.||:.:..|.||::||..|::|||...||:||..|||::..|:..
  Fly    21 RAAYHGGHGPHSTMNDLPVPAGDWKEQHSQKNAKYNAALITGILVLAGTIGFVKSSGIIHFNYYA 85

  Fly   135 PE 136
            |:
  Fly    86 PK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gomNP_524659.1 Deltameth_res 84..132 CDD:292639 21/47 (45%)
CG7630NP_652413.1 Deltameth_res 35..83 CDD:292639 21/47 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014255
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22133
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.